The domain within your query sequence starts at position 35 and ends at position 158; the E-value for the COG5 domain shown below is 3.8e-37.

SEFLNEDFDVKTYTSQSIHQAVIAEQLAKLAQGISQLDKELHLQVVARHEDLLAQATGIE
SLEGVLQMMQTRIGALQGAVDRMKSKIVEPYNKIVARTAQLARLQVACDLLRRIIRILYL
SKRL

COG5

 COG5
PFAM accession number:PF10392
Interpro abstract (IPR019465):

The conserved oligomeric Golgi (COG) complex is a peripheral membrane complex involved in intra-Golgi protein trafficking. Subunit 5 is located in the smaller, B lobe, together with subunits 6-8, and has been shown to bind subunits 1 and 7 [ (PUBMED:15932880) ].

Defects in COG5 are the cause of congenital disorder of glycosylation type 2I (CDG2I). A multisystem disorder caused by a defect in glycoprotein biosynthesis and characterised by under-glycosylated serum glycoproteins [ (PUBMED:19690088) ].

GO process:intra-Golgi vesicle-mediated transport (GO:0006891)
GO component:Golgi transport complex (GO:0017119)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry COG5