The domain within your query sequence starts at position 39 and ends at position 174; the E-value for the COG6 domain shown below is 5.5e-32.
LHKILETRLENDKEHLEALLKHVTAQGVKENIQEVVGHITEGVCRPLKVRIEQVILAEPG AVLLYKISNLLKFYHHTISGIVGNSAATLLTTIEEMHLLSKKIFFTSLSLHANKLMDKVE LPPPDLGPSSALSQTL
COG6 |
---|
PFAM accession number: | PF06419 |
---|---|
Interpro abstract (IPR010490): | COG6 is a component of the peripheral membrane COG complex that is involved in intra-Golgi protein trafficking. COG is located at the cis-Golgi, regulates tethering of retrograde intra-Golgi vesicles and possibly a number of other membrane trafficking events [ (PUBMED:12011112) (PUBMED:12006647) ]. |
GO process: | intra-Golgi vesicle-mediated transport (GO:0006891) |
GO component: | Golgi transport complex (GO:0017119) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry COG6