The domain within your query sequence starts at position 205 and ends at position 281; the E-value for the COQ9 domain shown below is 1.6e-39.

PHNIPPSLNLLTSMVDDMWHYAGDQSTDFNWYTRRAVLAGIYNTTELVMMQDSSPDFEDT
WRFLENRINDAMNMGHT

COQ9

COQ9
PFAM accession number:PF08511
Interpro abstract (IPR013718):

COQ9 is an enzyme that is required for the biosynthesis of coenzyme Q [ (PUBMED:16027161) ]. It may either catalyse a reaction in the coenzyme Q biosynthetic pathway or have a regulatory role.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry COQ9