SMART: Pfam domain COX7C

The domain within your query sequence starts at position 1 and ends at position 62; the E-value for the COX7C domain shown below is 8.5e-27.

MLGQSIRRFTTTMVCRSHYEEDPGKNLPFSVENKWRLLAMMILYFGSGLAAPFFIVRHQL
LK

COX7C

PFAM accession number:	PF02935
Interpro abstract (IPR004202):	Cytochrome c oxidase ( EC 1.9.3.1 ) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen [ (PUBMED:6307356) ]. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane. This entry represents cytochrome C subunit 7C. The yeast member of this family is called cytochrome C subunit 8P (Cox8).
GO function:	cytochrome-c oxidase activity (GO:0004129)

PFAM accession number:

PF02935

Interpro abstract (IPR004202):

Cytochrome c oxidase ( EC 1.9.3.1 ) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen [ (PUBMED:6307356) ]. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.

This entry represents cytochrome C subunit 7C. The yeast member of this family is called cytochrome C subunit 8P (Cox8).

GO function:

cytochrome-c oxidase activity (GO:0004129)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry COX7C