The domain within your query sequence starts at position 608 and ends at position 779; the E-value for the CPSF100_C domain shown below is 5.7e-46.

VRLKDSLVSSLQFCKAKDAELAWIDGVLDMRVSKVDTGVILEEGELKDDGEDSEMQVDAP
SDSSAMAQQKAMKSLFGEDEKELGEETEIIPTLEPLPPHEVPGHQSVFMNEPRLSDFKQV
LLREGIQAEFVGGVLVCNNQVAVRRTETGRIGLEGCLCQDFYRIRDLLYEQY

CPSF100_C

• PFAM accession number: PF13299
• Interpro abstract (IPR025069):

  This domain lies at the C terminus of many fungal and plant cleavage and polyadenylation specificity factor subunit 2 proteins. The exact function of the domain is not known, but is likely to function as a binding domain for the protein within the overall CPSF complex [ (PUBMED:19748916) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CPSF100_C