The domain within your query sequence starts at position 1 and ends at position 47; the E-value for the CPT_N domain shown below is 2.5e-29.
MAEAHQAVAFQFTVTPDGVDFRLSREALRHIYLSGINSWKKRLIRIK
CPT_N |
---|
PFAM accession number: | PF16484 |
---|---|
Interpro abstract (IPR032476): | This domain is found at the N terminus of carnitine O-palmitoyltransferases. It functions as a regulatory domain and is linked to the catalytic domain via two transmembrane regions [ (PUBMED:21990363) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CPT_N