The domain within your query sequence starts at position 171 and ends at position 248; the E-value for the CS domain shown below is 3.1e-19.

PNYRWTQTLAELDLAVPFRVSFRLKGKDVVVDIQRRHLRVGLKGQPPVVDGELYNEVKVE
ESSWLIEDGKVVTVHLEK

CS

 CS
PFAM accession number:PF04969
Interpro abstract (IPR007052):

The bipartite CS domain, which was named after CHORD-containing proteins and SGT1 [ (PUBMED:10571178) ], is a ~100-residue protein-protein interaction module. The CS domain can be found in stand-alone form, as well as fused with other domains, such as CHORD ( IPR007051 ), SGS ( IPR007699 ), TPR ( IPR019734 ), cytochrome b5 ( IPR001199 ) or b5 reductase, in multidomain proteins [ (PUBMED:12372593) ].

The CS domain has a compact antiparallel beta-sandwich fold consisting of seven beta-strands [ (PUBMED:12372593) (PUBMED:14761955) ].

Some proteins known to contain a CS domain are listed below [ (PUBMED:12372593) ]:

  • Eukaryotic proteins of the SGT1 family.
  • Eukaryotic Rar1, related to pathogenic resistance in plants, and to development in animals.
  • Eukaryotic nuclear movement protein nudC.
  • Eukaryotic proteins of the p23/wos2 family, which act as co-chaperone.
  • Animal b5+b5R flavo-hemo cytochrome NAD(P)H oxydoreductase type B.
  • Mammalian integrin beta-1-binding protein 2 (melusin).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CS