SMART: Pfam domain CSN8_PSD8

The domain within your query sequence starts at position 189 and ends at position 330; the E-value for the CSN8_PSD8_EIF3K domain shown below is 1.2e-40.

AYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVF
LAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFAEATRILFFSTPKKMTDYAKK
RGWVLGPNNYYSFASQQQKPED

CSN8_PSD8_EIF3K

PFAM accession number:	PF10075
Interpro abstract (IPR033464):	This domain is conserved from fungi, plants to humans. It is a signature protein motif found in components of CSN (COP9 signalosome) where it functions as a structural scaffold for subunit-subunit interactions within the complex and is a key regulator of photomorphogenic development [ (PUBMED:14636993) ]. It is found in Eukaryotic translation initiation factor 3 subunit K, a component of the eukaryotic translation initiation factor 3 (eIF-3) complex required for the initiation of protein synthesis [ (PUBMED:17581632) ]. It is also found in 26S proteasome non-ATPase regulatory subunit 8 (PSMD8), a regulatory subunit of the 26S proteasome [ (PUBMED:7621825) ].

PFAM accession number:

PF10075

Interpro abstract (IPR033464):

This domain is conserved from fungi, plants to humans. It is a signature protein motif found in components of CSN (COP9 signalosome) where it functions as a structural scaffold for subunit-subunit interactions within the complex and is a key regulator of photomorphogenic development [ (PUBMED:14636993) ]. It is found in Eukaryotic translation initiation factor 3 subunit K, a component of the eukaryotic translation initiation factor 3 (eIF-3) complex required for the initiation of protein synthesis [ (PUBMED:17581632) ]. It is also found in 26S proteasome non-ATPase regulatory subunit 8 (PSMD8), a regulatory subunit of the 26S proteasome [ (PUBMED:7621825) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CSN8_PSD8_EIF3K