The domain within your query sequence starts at position 10 and ends at position 106; the E-value for the CTNNB1_binding domain shown below is 5.7e-39.

TVAPGVSLLQQLGAWHLNLNCWSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPA
DVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGW

CTNNB1_binding

CTNNB1_binding
PFAM accession number:PF08347
Interpro abstract (IPR013558):

This region tends to appear at the N terminus of proteins also containing DNA-binding HMG (high mobility group) boxes ( IPR009071 ) and appears to bind the armadillo repeat of CTNNB1 (beta-catenin), forming a stable complex. Signalling by Wnt through TCF/LCF is involved in developmental patterning, induction of neural tissues, cell fate decisions and stem cell differentiation [ (PUBMED:15765502) ]. Isoforms of HMG T-cell factors lacking the N-terminal CTNNB1-binding domain cannot fulfil their role as transcriptional activators in T-cell differentiation [ (PUBMED:10080941) (PUBMED:9783587) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CTNNB1_binding