The domain within your query sequence starts at position 144 and ends at position 183; the E-value for the CUE domain shown below is 4.6e-7.
PGVDVLLEVFPTCSMEQAQWVLAKARGDLEEAVHMLVEGK
CUE |
![]() |
---|
PFAM accession number: | PF02845 |
---|---|
Interpro abstract (IPR003892): | This domain promotes intramolecular monoubiquitination and has a dual role in mono- and poly-ubiquitination recognition, being involved in binding ubiquitin-conjugating enzymes (UBCs) [ (PUBMED:12573224) (PUBMED:12628920) (PUBMED:23665229) ]. CUE domains also occur in two proteins of the IL-1 signal transduction pathway, tollip and TAB2. |
GO function: | protein binding (GO:0005515) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CUE