The domain within your query sequence starts at position 1 and ends at position 79; the E-value for the CaM-KIIN domain shown below is 1.6e-49.
MSEILPYGEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIE DDRIDDVLKGMGEKPPSGV
CaM-KIIN |
 |
|---|
| PFAM accession number: | PF15170 |
|---|---|
| Interpro abstract (IPR026779): | This family includes calcium/calmodulin-dependent protein kinase II inhibitor 1 and 2 (CAMK2N1 and CAMK2N2). They are potent and specific inhibitor of CaM-kinase II (CAMK2) [ (PUBMED:11182241) ]. |
| GO function: | protein kinase inhibitor activity (GO:0004860) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CaM-KIIN