The domain within your query sequence starts at position 799 and ends at position 933; the E-value for the Cadherin_tail domain shown below is 5.3e-58.
PRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQQWPTVSSATPEPEAGEVSPPV GAGVNSNSWTFKYGPGNPKQSGPGELPDKFIIPGSPAIISIRQEPANNQIDKSDFITFGK KEETKKKKKKKKGNK
Cadherin_tail |
![]() |
---|
PFAM accession number: | PF15974 |
---|---|
Interpro abstract (IPR031904): | This is the cytoplasmic catenin-binding domain found at the C terminus of cadherin [ (PUBMED:9865466) ]. This domain binds to the ARM domain of beta-catenin, a catenin that plays a crucial role in the regulation of cell-cell adhesion at adherens junctions (AJs) [ (PUBMED:20371349) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cadherin_tail