The domain within your query sequence starts at position 1 and ends at position 149; the E-value for the Calc_CGRP_IAPP domain shown below is 2.6e-31.

MKLVSITLMLLGSLAFLGADTAGPDTPSQFRKKWNKWALSRGKRELQASSSYPTGLADET
TVPTQTLDPFLDEQNTTGPLQASNQSEAHIRVKRYRQSMNQGSRSNGCRFGTCTFQKLAH
QIYQLTDKDKDGMAPRNKISPQGYGRRRR

Calc_CGRP_IAPP

 Calc_CGRP_IAPP
PFAM accession number:PF00214
Interpro abstract (IPR021116):

Calcitonin [ (PUBMED:3060108) ] is a 32 amino acid polypeptide hormone that causes a rapid but short-lived drop in the level of calcium and phosphate in the blood, by promoting the incorporation of these ions in the bones. This is the alpha type. Alternative splicing of the gene coding for calcitonin produces a distantly related peptide of 37 amino acids, called calcitonin gene-related peptide (CGRP), beta type. CGRP induces vasodilatation in a variety of vessels, including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.

Islet amyloid polypeptide (IAPP) [ (PUBMED:2407732) ] (also known as diabetes-associated peptide (DAP), or amylin) is a peptide of 37 amino acids that selectively inhibits insulin-stimulated glucose utilisation and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism. Structurally, IAPP is closely related to CGRP.

Calcitonin receptor-stimulating peptide 1 stimulates cAMP production via the calcitonin receptor.

Two conserved cysteines in the N-terminal of these peptides are known to be involved in a disulphide bond. The C-terminal residue of all three peptides is amidated.


                xCxxxxxCxxxxxxxxxxxxxxxxxxxxxxxxxxxx-NH(2)
                 |     |                             Amide group
                 +-----+

'C': conserved cysteine involved in a disulphide bond.

This entry represents procalcitonin (before cleavage into the calcitonin peptide) and adrenomedullin.

GO component:extracellular region (GO:0005576)
GO function:hormone activity (GO:0005179)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Calc_CGRP_IAPP