The domain within your query sequence starts at position 196 and ends at position 271; the E-value for the Cep57_MT_bd domain shown below is 2.6e-24.
KKSVVPPSSSVNEELSDVLQTLQDEFGQMSFDHQQLTKLIQESPTVELKDNLECELEALV GRMEAKANQITKVRKY
Cep57_MT_bd |
 |
|---|
| PFAM accession number: | PF06657 |
|---|---|
| Interpro abstract (IPR024957): | This C-terminal domain of Cep57 binds, nucleates and bundles microtubules. The N-terminal part of the protein is the centrosome localisation domain [ (PUBMED:18294141) ]. |
| GO function: | microtubule binding (GO:0008017) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cep57_MT_bd