SMART: Pfam domain Chisel

The domain within your query sequence starts at position 1 and ends at position 85; the E-value for the Chisel domain shown below is 5.3e-49.

MSKQPISNVRAIQANINIPMGAFRPGAGQPPRRKESTPETEEGAPTTSEEKKPIPGMKKF
PGPVVNLSEIQNVKSELKFVPKGEQ

Chisel

PFAM accession number:	PF15355
Interpro abstract (IPR029268):	Chisel protein plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair. The X-linked gene Chisel (Csl/Smpx) was first found expressed selectively in human cardiac and skeletal muscle cells [ (PUBMED:10598820) ]. It is expressed in embryos in sub-regions of the developing heart corresponding to the future chamber myocardium and in developing skeletal muscles [ (PUBMED:15893749) ]. It is a potential target of the cardiac homeodomain transcription factor Nkx2-5 [ (PUBMED:11381084) ]. It localises to the costameric cytoskeleton of muscle cells through its association with focal adhesion proteins, where it may participate in regulating the dynamics of actin through the Rac1/p38 kinase pathway [ (PUBMED:15893749) ].

PFAM accession number:

PF15355

Interpro abstract (IPR029268):

Chisel protein plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair. The X-linked gene Chisel (Csl/Smpx) was first found expressed selectively in human cardiac and skeletal muscle cells [ (PUBMED:10598820) ]. It is expressed in embryos in sub-regions of the developing heart corresponding to the future chamber myocardium and in developing skeletal muscles [ (PUBMED:15893749) ]. It is a potential target of the cardiac homeodomain transcription factor Nkx2-5 [ (PUBMED:11381084) ]. It localises to the costameric cytoskeleton of muscle cells through its association with focal adhesion proteins, where it may participate in regulating the dynamics of actin through the Rac1/p38 kinase pathway [ (PUBMED:15893749) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Chisel