The domain within your query sequence starts at position 1 and ends at position 47; the E-value for the CholecysA-Rec_N domain shown below is 8.8e-29.

MDVVDSLLMNGSNITPPCELGLENETLFCLDQPQPSKEWQSAVQILL

CholecysA-Rec_N

 CholecysA-Rec_N
PFAM accession number:PF09193
Interpro abstract (IPR015276):

This entry represents the extracellular N-terminal domain of the cholecystokinin A receptor. This domain adopts a tertiary structure consisting of a few helical turns and a disulphide-cross linked loop. It is required for interaction of the cholecystokinin A receptor with its corresponding hormonal ligand [ (PUBMED:10555959) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CholecysA-Rec_N