The domain within your query sequence starts at position 1 and ends at position 197; the E-value for the Chon_Sulph_att domain shown below is 1.6e-99.
MAAVGPGVGPEEALEASAAVTGTAWLEADGPGLGGVTAEAGSGDAQTLPATLQAPDEALG SSTMPPAIPEATETSGPPSPAVHDKPSVGPELPKEIPLEVRLNLGGSTPEPTFPLQGTLE TQPASDIIDIDYFEGLDSEGRGADMGSFPGSPGTSENHPDTEGETPSWSLLDLYDDFTPF DESDFYPTTSFYDDLEE
Chon_Sulph_att |
---|
PFAM accession number: | PF06566 |
---|---|
Interpro abstract (IPR010555): | This entry represents the chondroitin sulphate attachment domain of Chondroitin sulfate proteoglycan 5 (CSPG5, also known as CALEB), which mediates dendritic tree and spine complexity [ (PUBMED:17431398) ]. This domain contains several potential sites of chondroitin sulphate attachment, as well as potential sites of N-linked glycosylation [ (PUBMED:9950058) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Chon_Sulph_att