The domain within your query sequence starts at position 479 and ends at position 537; the E-value for the Chromosome_seg domain shown below is 8.8e-22.
RLLCYLLHLRFRSSRSGRLSLHGDIRLLFSRRSLELDTGLPYELQAVTEAPHNPRYSPL
Chromosome_seg |
---|
PFAM accession number: | PF13889 |
---|---|
Interpro abstract (IPR033473): | This domain can be found in the C terminus of the animal FAM241 proteins and the fission yeast SPAC3H8.04 protein. The function of the FAM241 proteins is not clear. From a high-throughput knockout screen, SPAC3H8.04 was identified as a protein required for meiotic chromosome segregation [ (PUBMED:16169489) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Chromosome_seg