The domain within your query sequence starts at position 1 and ends at position 65; the E-value for the Churchill domain shown below is 2.4e-31.
MCGDCVEKEYPNRGTTCLENGSFLLNFAGCAVCSKRDFMLITNRSLKEEDGEEIVTYDRQ SRRED
Churchill |
 |
|---|
| PFAM accession number: | PF06573 |
|---|---|
| Interpro abstract (IPR009508): | This family consists of several eukaryotic Churchill proteins. This protein contains a novel zinc binding region that mediates FGF signalling during neural development. The slow induction by FGF of a transcription factor (Churchill) in the neural plate in turn induces expression of Sip1 (Smad interacting protein-1), which inhibits mesodermal genes and sensitizes cells to later neural inducing factors [ (PUBMED:14651843) ]. |
| GO process: | multicellular organism development (GO:0007275), positive regulation of transcription, DNA-templated (GO:0045893) |
| GO function: | zinc ion binding (GO:0008270) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Churchill