The domain within your query sequence starts at position 1 and ends at position 92; the E-value for the Churchill domain shown below is 1.9e-42.

MCGDCVEKEYPNRGTTCLENGSFLLNFAGCAVCSKRDFMLITNRSLKEEDGEEIVTYDHL
CKNCHHVVARHEYTFSIMDEFQAKVEEKIQEV

Churchill

Churchill
PFAM accession number:PF06573
Interpro abstract (IPR009508):

This family consists of several eukaryotic Churchill proteins. This protein contains a novel zinc binding region that mediates FGF signalling during neural development. The slow induction by FGF of a transcription factor (Churchill) in the neural plate in turn induces expression of Sip1 (Smad interacting protein-1), which inhibits mesodermal genes and sensitizes cells to later neural inducing factors [ (PUBMED:14651843) ].

GO process:positive regulation of transcription, DNA-templated (GO:0045893), multicellular organism development (GO:0007275)
GO function:zinc ion binding (GO:0008270)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Churchill