The domain within your query sequence starts at position 312 and ends at position 423; the E-value for the Clp1 domain shown below is 1.3e-34.

FYPHAFNVKFSDVKIYKVGAPTIPDSCLPLGMSQEDNQLKLVPVTPGRDMVHHLLSVSTA
EGTEENLSETSVAGFIVVTSVDVEHQVFTVLSPAPRPLPKNFLLIMDIRFMD

Clp1

Clp1
PFAM accession number:PF06807
Interpro abstract (IPR010655):

The yeast Clp1 is a subunit of cleavage factor IA (CF IA) and is involved in mRNA cleavage and polyadenylation [ (PUBMED:22216186) ]. Clp1 also mediates interactions between CF IA and another complex of the yeast mRNA cleavage and polyadenylation machinery, the Cleavage-Polyadenylation Factor (CPF) [ (PUBMED:21993299) ]. It seems that human Clp1 and yeast Clp1 are not functional orthologues [ (PUBMED:18648070) ]. Human Clp1, and its archeal homologue [ (PUBMED:19299550) ], but not yeast Clp1, are 5'-OH polynucleotide kinases. In humans Clp1 functions as a RNA kinase important in tRNA splicing [ (PUBMED:18648070) (PUBMED:24766809) ], and is also implicated in mRNA and siRNA maturation [ (PUBMED:15109492) (PUBMED:17495927) (PUBMED:17786051) ].

This entry represents the C-terminal domain of Clp1.

GO process:mRNA 3'-end processing (GO:0031124)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Clp1