The domain within your query sequence starts at position 485 and ends at position 651; the E-value for the Cmyb_C domain shown below is 4.1e-74.
FSPSQFFNTCPGNEQLNIENPSFTSTPICGQKVLITTPLQKEATPKDQKENVGFRTPTIR RSILGTTPRTPTPFKNALAAQEKKYGPLKIVSQPLAFLEEDIREVLKEETGTDIFLKEED EPAYKSCKQEHSASVKKVRKSLALESWDKEEPGTQLLTEDISDMQSN
Cmyb_C |
![]() |
---|
PFAM accession number: | PF09316 |
---|---|
Interpro abstract (IPR015395): | This entry represents the C-terminal domain of the proto-oncogene c-myb and the viral transforming protein myb. Truncation of the domain results in 'activation' of c-myb and subsequent tumourigenesis [ (PUBMED:2670562) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cmyb_C