The domain within your query sequence starts at position 557 and ends at position 863; the E-value for the Cnd3 domain shown below is 7.4e-87.
KCLVLCYELLKQMSTSTGITATMNGIIESLILPGIISVHPIVRNLAVLCLGCCGLQNRDF ASKHFMLFLQVLQIDDVTIKISALKAIIDQLMMFGIEPFKTQKVKGVQCEGEEINCHDKQ EENDAGETDPAKSVLKLLSDFLDSEVSELRTGAAEGLAKLMFSGLLVSSRILSRLILLWY NPVTEEDVRLRHCLGVFFPMFAYANRTNQECFEEAFIPTVQTLANAPVSSPLAEVDVTNV VELLVDLTRPSRLNPKAKNSQDYQALTVHDNLAIKICNEILTSPCSPENRVYTKALSLVE LSSNVTK
Cnd3 |
---|
PFAM accession number: | PF12719 |
---|---|
Interpro abstract (IPR025977): | The Cnd1-3 proteins are the three non-SMC (structural maintenance of chromosomes) proteins that go to make up the mitotic condensation complex along with the two SMC protein families, XCAP-C and XCAP-E, (or in the case of fission yeast, Cut3 and Cut14) [ (PUBMED:10485849) ]. The five-member complex seems to be conserved from yeasts to vertebrates. This domain is the C-terminal, cysteine-rich domain of Cnd3. The complex shuttles between the nucleus, during mitosis, and the cytoplasm during the rest of the cycle. Thus this family is made up of the C-termini of XCAP-Gs, Ycg1 and Ycs5 members. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cnd3