The domain within your query sequence starts at position 484 and ends at position 590; the E-value for the CoA_binding domain shown below is 3.9e-14.
SRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILIPVF KNMADAMKKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEG
CoA_binding |
 |
|---|
| PFAM accession number: | PF02629 |
|---|---|
| Interpro abstract (IPR003781): | This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CoA_binding