The domain within your query sequence starts at position 494 and ends at position 600; the E-value for the CoA_binding domain shown below is 6.6e-15.
SRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILIPVF KNMADAMKKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEG
CoA_binding |
---|
PFAM accession number: | PF02629 |
---|---|
Interpro abstract (IPR003781): | This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CoA_binding