The domain within your query sequence starts at position 144 and ends at position 235; the E-value for the Cobl domain shown below is 2.2e-46.
KPGLTKAPEKSVRLVVNYLRTQKAVVRVSPEVPLQNILPVICAKCEVNPEHVILLRDNVA GEELELSKSLNELGIKELYAWDNRREMFRKSS
Cobl |
 |
|---|
| PFAM accession number: | PF09469 |
|---|---|
| Interpro abstract (IPR019025): | The Cordon-bleu protein domain is highly conserved among vertebrates. The sequence contains three repeated lysine, arginine, and proline-rich regions, the KKRAP motif. The exact function of the protein is unknown but it is thought to be involved in mid-brain neural tube closure. It is expressed specifically in the node [ (PUBMED:14512015) ]. This domain has a ubiquitin-like fold. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cobl