SMART: Pfam domain Coilin

The domain within your query sequence starts at position 10 and ends at position 220; the E-value for the Coilin_N domain shown below is 8.7e-35.

VRLRLQFDYPPPATPHCTVFWLLVDLNRCRVVTDLISLIRQRFGFSSGALLGLYLEGGLL
PPAESARLVRDNDSLRVKLEDQGLPENLIVSNGGDSSFPCRKAKKRAFKLMEDEETDQGY
KSLKKHCKRQEDSGQNEKASDLETKLLPDETGRTKSKKKSKVTGSPAEEDEEETKKKSSK
RKEKCEPKKQTRASKSSKQQTPKEGASQNCS

Coilin_N

PFAM accession number:	PF15862
Interpro abstract (IPR031722):	Coilin is a nuclear phosphoprotein that concentrates within Cajal bodies (CBs) and has a role in small nuclear ribonucleoprotein (snRNP) biogenesis [ (PUBMED:15862129) ]. Coilin also acts to repress polymerase I activity in response to cisplatin-induced DNA damage, which could indicate a link between the DNA damage response and the inhibition of rRNA synthesis [ (PUBMED:21289084) ]. Conservation at the amino acid level is highest within coilin's N- and C-termini. The first N-terminal 92-amino acid domain have been shown to self-interact and to be essential for proper targeting of coilin to CBs [ (PUBMED:7490287) (PUBMED:11102515) ].

PFAM accession number:

PF15862

Interpro abstract (IPR031722):

Coilin is a nuclear phosphoprotein that concentrates within Cajal bodies (CBs) and has a role in small nuclear ribonucleoprotein (snRNP) biogenesis [ (PUBMED:15862129) ]. Coilin also acts to repress polymerase I activity in response to cisplatin-induced DNA damage, which could indicate a link between the DNA damage response and the inhibition of rRNA synthesis [ (PUBMED:21289084) ].

Conservation at the amino acid level is highest within coilin's N- and C-termini. The first N-terminal 92-amino acid domain have been shown to self-interact and to be essential for proper targeting of coilin to CBs [ (PUBMED:7490287) (PUBMED:11102515) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Coilin_N