The domain within your query sequence starts at position 85 and ends at position 207; the E-value for the Complex1_30kDa domain shown below is 1.9e-43.
ICIHPDGVIPTLTFLRDHTNAQFKSLADLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKT YADELTPIDSIVSVHIAANWYEREVWDMFGVFFFNHPDLRRILTDYGFEGHPFRKDFPLT GYV
Complex1_30kDa |
 |
|---|
| PFAM accession number: | PF00329 |
|---|---|
| Interpro abstract (IPR001268): | The 30kDa subunit from NADH:ubiquinone oxidoreductase is found in both eukaryotes and prokaryotes. In mammals and in Neurospora crassa, it is nuclear-encoded as a precursor form with a transit peptide, while in Paramecium (protein P1), in the Dictyostelium discoideum (Slime mold) it is mitochondrial-encoded and it is chloroplast-encoded in various higher plants. It is also present in bacteria. NADH:ubiquinone oxidoreductase (complex I) ( EC 1.6.5.3 ) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) [ (PUBMED:1470679) ]. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [ (PUBMED:10940377) ], mitochondria, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins [ (PUBMED:18394423) ]. |
| GO process: | oxidation-reduction process (GO:0055114) |
| GO function: | NADH dehydrogenase (ubiquinone) activity (GO:0008137) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Complex1_30kDa