The domain within your query sequence starts at position 212 and ends at position 361; the E-value for the Condensin2nSMC domain shown below is 7.2e-62.
ECFINVNYIKKEEGRRFLSFLFSWNVDFIKMIHETIKNQLAGLQKSLMVHIAEIYFRAWK KASGKMLETIEYDCIQDFMFHGIHLLRRSPVHSKVREVLSYFHQQKVRQGVEEMLYRLYK PILWRGLKARNSEVRSNAALLFVEAFPIRD
Condensin2nSMC |
![]() |
---|
PFAM accession number: | PF12422 |
---|---|
Interpro abstract (IPR024741): | Subunit G2 is a non-SMC subunit of condensin II, which is involved in maintenance of the structural integrity of chromosomes. Condensin II is made up of SMC (structural maintenance of chromosomes) and non-SMC subunits. The non-SMC subunits bind to the catalytic ends of the SMC subunit dimer. The condensin holocomplex is able to introduce superhelical tension into DNA in an ATP hydrolysis- dependent manner, resulting in the formation of positive supercoils in the presence of topoisomerase I and of positive knots in the presence of topoisomerase II [ (PUBMED:14532007) ]. |
GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Condensin2nSMC