SMART: Pfam domain Connexin40

The domain within your query sequence starts at position 257 and ends at position 358; the E-value for the Connexin40_C domain shown below is 2.4e-33.

LVQSLTPPPDFNQCLKNSSGEKFFSDFSNNMGSRKNPDALATGEVPNQEQIPGEGFIHMH
YSQKPEYASGASAGHRLPQGYHSDKRRLSKASSKARSGGFTV

Connexin40_C

PFAM accession number:	PF16791
Interpro abstract (IPR031862):	This entry represents the C-terminal domain of connexin 40 (Cx40). It interacts with the C-terminal and cytoplasmic loop domains of connexin 43 and with the cytoplasmic loop of another connexin 40 [ (PUBMED:19808665) ]. Connexin 40 is a gap junction protein that has been linked to lone atrial fibrillation [ (PUBMED:24733048) ]. Gap junctions is composed of two hemichannels, each constituted by the oligomerisation of six connexins (Cx). This junction allows direct exchange of ions and small molecules between apposing cells [ (PUBMED:24733048) ].

PFAM accession number:

PF16791

Interpro abstract (IPR031862):

This entry represents the C-terminal domain of connexin 40 (Cx40). It interacts with the C-terminal and cytoplasmic loop domains of connexin 43 and with the cytoplasmic loop of another connexin 40 [ (PUBMED:19808665) ].

Connexin 40 is a gap junction protein that has been linked to lone atrial fibrillation [ (PUBMED:24733048) ]. Gap junctions is composed of two hemichannels, each constituted by the oligomerisation of six connexins (Cx). This junction allows direct exchange of ions and small molecules between apposing cells [ (PUBMED:24733048) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Connexin40_C