The domain within your query sequence starts at position 598 and ends at position 709; the E-value for the Consortin_C domain shown below is 3.4e-56.
EAIPAEGLVSILKKRNDTVGSHPAQMQQKPAKRRVRFQEIDDNLEQDEVGGGSCILLILL CIATVFLSVGGTALYCTLGNIESPVCTDFADNVDFYYTKLLQGVAGLKHWVY
Consortin_C |
![]() |
---|
PFAM accession number: | PF15281 |
---|---|
Interpro abstract (IPR028129): | Consortin is a trans-Golgi network cargo receptor involved in targeting connexins to the plasma membrane [ (PUBMED:19864490) ]. This entry represents the C-terminal domain of consortin. |
GO process: | positive regulation of Golgi to plasma membrane protein transport (GO:0042998) |
GO component: | trans-Golgi network (GO:0005802) |
GO function: | connexin binding (GO:0071253) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Consortin_C