The domain within your query sequence starts at position 60 and ends at position 189; the E-value for the Cor1 domain shown below is 4.8e-50.
NKTLHIKRKRMETYIKDSFKDSNQKLEQLWKTNKQERKKINNKFCEQYITTFQKFDMDVQ KFNEEQEKSVNNYQKEEQALKLSKCSQSQTLEAIKDMHEKYMEGLMNLETNNYNVLFDVD GELRKEMSVF
Cor1 |
![]() |
---|
PFAM accession number: | PF04803 |
---|---|
Interpro abstract (IPR006888): | This entry represents a conserved region found in the members of the FAM9 and XLR/SYCP3 families. SYCP3, also known as COR1, is a component of the transverse filaments of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase [ (PUBMED:10678170) (PUBMED:22346761) ]. The function of FAM9 and XLR is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cor1