The domain within your query sequence starts at position 53 and ends at position 152; the E-value for the Cornichon domain shown below is 1.3e-26.
RLRNIERICFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADS SELAYDPPVVMNADTLSYCQKEAWCKLAFYLLSFFYYLYC
Cornichon |
![]() |
---|
PFAM accession number: | PF03311 |
---|---|
Interpro abstract (IPR003377): | This entry represents a group of conserved proteins from fungi, plants to animals. They are transmembrane proteins. Proteins in this entry include budding yeast Erv14/15, Drosophila Cornichon and human CNIH1/2/3/4. The drosophila cornichon protein (gene: cni), the founding member of this family, is an integral component of the COPII-coated vesicles that mediate cargo export from the yeast endoplasmic reticulum (ER) [ (PUBMED:16396907) ]. It is required in the germline for dorsal-ventral signalling. The dorsal-ventral pattern formation involves a reorganisation of the microtubule network correlated with the movement of the oocyte nucleus, and depending on the initial correct establishment of the anterior-posterior axis via a signal from the oocyte produced by cornichon and gurken and received by torpedo protein in the follicle cells [ (PUBMED:7540118) ]. Erv14 is a COPII-coated vesicle protein involved in vesicle formation and incorporation of specific secretory cargo. It is required for axial budding [ (PUBMED:9732282) (PUBMED:17298976) ]. CNIH1 is involved in the selective transport and maturation of TGF-alpha family proteins [ (PUBMED:17607000) ]. |
GO process: | vesicle-mediated transport (GO:0016192) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cornichon