SMART: Pfam domain Cortexin

The domain within your query sequence starts at position 7 and ends at position 82; the E-value for the Cortexin domain shown below is 7.3e-44.

LSPEPLPPSTGPPVGAGLDVEQRTVFAFVLCLLVVLVLLMVRCVRILLDPYSRMPASSWT
DHKEALERGQFDYALV

Cortexin

PFAM accession number:	PF11057
Interpro abstract (IPR020066):	Cortexin is a neuron-specific, 82-residue membrane protein which is found especially in vertebrate brain cortex tissue. It may mediate extracellular or intracellular signalling of cortical neurons during forebrain development. Cortexin is present at significant levels in the foetal brain, suggesting that it may be important to neurons of both the developing and adult cerebral cortex. Cortexin has a conserved single membrane-spanning region in the middle of each sequence [ (PUBMED:8336151) ]. In humans, there is selective expression of Cortexin 3 (CTXN3) in the kidney as well as the brain [ (PUBMED:17786280) ]. This entry contains Cortexins 1, 2 and 3, and Cortexin domain-containing proteins.

PFAM accession number:

PF11057

Interpro abstract (IPR020066):

Cortexin is a neuron-specific, 82-residue membrane protein which is found especially in vertebrate brain cortex tissue. It may mediate extracellular or intracellular signalling of cortical neurons during forebrain development. Cortexin is present at significant levels in the foetal brain, suggesting that it may be important to neurons of both the developing and adult cerebral cortex. Cortexin has a conserved single membrane-spanning region in the middle of each sequence [ (PUBMED:8336151) ]. In humans, there is selective expression of Cortexin 3 (CTXN3) in the kidney as well as the brain [ (PUBMED:17786280) ]. This entry contains Cortexins 1, 2 and 3, and Cortexin domain-containing proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cortexin