The domain within your query sequence starts at position 3 and ends at position 113; the E-value for the Ctf8 domain shown below is 4.3e-26.
QIVISSTGAEGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILYGK TIHLEKPFAVLVKHTPGKQDCDEPGRGTGTQYLVTALIKNKILFKTRPKPI
Ctf8 |
![]() |
---|
PFAM accession number: | PF09696 |
---|---|
Interpro abstract (IPR018607): | Ctf8 is a component of the RFC-like complex CTF18-RFC which is required for efficient establishment of chromosome cohesion during S-phase and may load or unload POL30/PCNA. During a clamp loading circle, the RFC:clamp complex binds to DNA and the recognition of the double-stranded/single-stranded junction stimulates ATP hydrolysis by RFC [ (PUBMED:11389843) (PUBMED:15964801) ]. |
GO process: | mitotic sister chromatid cohesion (GO:0007064) |
GO component: | Ctf18 RFC-like complex (GO:0031390) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ctf8