The domain within your query sequence starts at position 23 and ends at position 224; the E-value for the CutC domain shown below is 7.7e-82.

FLMEVCVDSVESAVNAERGGAGRIELCSGLLEGGTTPSMGVLQVVKQSVQIPVFVMIRPR
GGDFLYSDREVEVMKADIRLAKLYGADGLVFGALTEDGHIDKELCLSLVALCRPLPVTFH
RAFDMVHDPMAALETLLTLGFERVLTSGCDSSALEGLPLIKQLIDQAKGRIVVMPGGGIT
DKNLQRILEGSGATEFHCSARS

CutC

 CutC
PFAM accession number:PF03932
Interpro abstract (IPR023648):

CutC is a protein involved in copper homeostasis [ (PUBMED:7635807) ]. Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF. A mutation in one or more of these genes results in an increased copper sensitivity.

The CutC monomer structure adopts a common TIM beta/alpha barrel with 8 beta strands surrounded by 8 alpha helices [ (PUBMED:15624211) ].

GO process:copper ion homeostasis (GO:0055070)
GO function:copper ion binding (GO:0005507)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CutC