The domain within your query sequence starts at position 439 and ends at position 534; the E-value for the CwfJ_C_2 domain shown below is 2.1e-19.
AQEQQIELLEIPEHSDIKQIAQPGAAYFYVELDTGEKLFHRIKKNFPLQFGREVLASEAI LNIPEKADWRQCQTSKDEEEALARRFRKDFEPFDFT
CwfJ_C_2 |
 |
|---|
| PFAM accession number: | PF04676 |
|---|---|
| Interpro abstract (IPR006767): | This group of sequences contain a conserved C-terminal domain which is found in the Schizosaccharomyces pombe (Fission yeast) protein Cwf19 ( Q09909 ) and its homologues. Cwf19 is part of the Cdc5p complex involved in mRNA splicing [ (PUBMED:11884590) ]. This domain is found in association with IPR006768 which is generally N-terminal and adjacent to this domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CwfJ_C_2