The domain within your query sequence starts at position 44 and ends at position 170; the E-value for the Cyclin domain shown below is 1.2e-9.

DLETDCSLEELSSPVADITVELLQKAAPSPIRRLQKKYVAHVSREACISPCAMMLALVYI
ERLRHRNPDYLQHVSSSDLFLISMMVASKYLYDEGEEEEVFNDEWGAAGGVAVATLNALE
RSFLSAM

Cyclin

 Cyclin
PFAM accession number:PF08613
Interpro abstract (IPR013922):

Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [ (PUBMED:12910258) ], and regulate cyclin dependent kinases (CDKs). Cyclins, together with the p34 (cdc2) or cdk2 kinases, form the Maturation Promoting Factor (MPF). There are two main groups of cyclins, G1/S cyclins, which are essential for the control of the cell cycle at the G1/S (start) transition, and G2/M cyclins, which are essential for the control of the cell cycle at the G2/M (mitosis) transition. G2/M cyclins accumulate steadily during G2 and are abruptly destroyed as cells exit from mitosis (at the end of the M-phase). In most species, there are multiple forms of G1 and G2 cyclins. For example, in vertebrates, there are two G2 cyclins, A and B, and at least three G1 cyclins, C, D, and E.

Cyclin homologues have been found in various viruses, including Saimiriine herpesvirus 2 (Herpesvirus saimiri) and Human herpesvirus 8 (HHV-8) (Kaposi's sarcoma-associated herpesvirus). These viral homologues differ from their cellular counterparts in that the viral proteins have gained new functions and eliminated others to harness the cell and benefit the virus [ (PUBMED:11056549) ].

This entry includes cyclin PHO80 and other cyclins that partner with the cyclin-dependent kinase (CDK) PHO85. The PHO80/PHO85 cyclin-cdk complex is used for a regulatory process other than cell-cycle control [ (PUBMED:8108735) ]. This entry also includes other PHO80-like cyclins that are involved in the cell-cycle control. They belong to the P/U family and interact preferentially with CDKA1 [ (PUBMED:15197472) ].

GO process:regulation of cyclin-dependent protein serine/threonine kinase activity (GO:0000079)
GO function:protein kinase binding (GO:0019901)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cyclin