The domain within your query sequence starts at position 72 and ends at position 185; the E-value for the Cys_knot domain shown below is 1.2e-7.
QVGCRELRSTKYISDGQCTSISPLKELVCAGECLPLPVLPNWIGGGYGTKYWSRRSSQEW RCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFESVSPA
Cys_knot |
 |
|---|
| PFAM accession number: | PF00007 |
|---|---|
| Interpro abstract (IPR006208): | This domain is found at the C-terminal of glycoprotein hormones and various extracellular proteins. It is believed to be involved in disulphide-linked dimerisation [ (PUBMED:7687569) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cys_knot