The domain within your query sequence starts at position 341 and ends at position 438; the E-value for the CytochromB561_N domain shown below is 2.2e-46.
NIIMHVFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPNKPDVTNENVFCIYQSAVNPPHYE LIYQRHVYNLPKGRNNMFHTLLMFLYIIKTKESGMLGN
CytochromB561_N |
 |
|---|
| PFAM accession number: | PF09786 |
|---|---|
| Interpro abstract (IPR019176): | Members of this family include cytochrome B561, as well as various other putative, uncharacterised proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CytochromB561_N