The domain within your query sequence starts at position 372 and ends at position 519; the E-value for the CytochromB561_N domain shown below is 3.1e-79.
IGELSQGGCMSSFRWNRGGDFKGRKWDTDLPTDSAIIMHVFCTYLDSRLPPHPKYPDGKT FTSQHFVQTPNKPDVTNENVFCIYQSAVNPPHYELIYQRHVYNLPKGRNNMFHTLLMFLY IIKTKESGMLGRVNLGLSGVNILWIFGE
CytochromB561_N |
![]() |
---|
PFAM accession number: | PF09786 |
---|---|
Interpro abstract (IPR019176): | Members of this family include cytochrome B561, as well as various other putative, uncharacterised proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CytochromB561_N