The domain within your query sequence starts at position 366 and ends at position 406; the E-value for the DAGK_acc domain shown below is 9.7e-15.

TMNNYFSVGPDALMALNFHAHREKAPSLFSSRILNKVCWIK

DAGK_acc

 DAGK_acc
PFAM accession number:PF00609
Interpro abstract (IPR000756):

Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity [ (PUBMED:3291115) ]:

  • Serine/threonine-protein kinases
  • Tyrosine-protein kinases
  • Dual specificity protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)

Protein kinase function is evolutionarily conserved from Escherichia coli to human [ (PUBMED:12471243) ]. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation [ (PUBMED:12368087) ]. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [ (PUBMED:15078142) ], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases [ (PUBMED:15320712) ].

Diacylglycerol (DAG) is a second messenger that acts as a protein kinase C activator. The DAG kinase domain is assumed to be an accessory domain. Upon cell stimulation, DAG kinase converts DAG into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity. It catalyses the reaction: ATP + 1,2-diacylglycerol = ADP + 1,2-diacylglycerol 3-phosphate. The enzyme is stimulated by calcium and phosphatidylserine and phosphorylated by protein kinase C. This domain is always associated with IPR001206 .

GO process:protein kinase C-activating G protein-coupled receptor signaling pathway (GO:0007205)
GO function:diacylglycerol kinase activity (GO:0004143)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DAGK_acc