The domain within your query sequence starts at position 3 and ends at position 62; the E-value for the DAP domain shown below is 4.5e-15.

ARGSRSILIPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHVSPRTQHIQQPRK

DAP

• PFAM accession number: PF15228
• Interpro abstract (IPR024130):

  This family includes death-associated protein 1 (DAP1) and death-associated protein-like 1 (DAPL1). DAP1 is involved in mediating interferon-gamma-induced cell death [ (PUBMED:7828849) ]. DAPL1 may play a role in the early stages of epithelial differentiation or in apoptosis [ (PUBMED:15920738) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DAP