SMART: Pfam domain DCAF15

The domain within your query sequence starts at position 48 and ends at position 259; the E-value for the DCAF15_WD40 domain shown below is 1.1e-84.

QLSPRLFRKLPPRVCVSLKNIVDEDFLYAGHIFLGFSKCGRYVLSYTSSSGDDDFSFYIY
HLYWWEFNVHSKLKLVRQVRLFQDEEIYSDLYLTVCEWPSDASKVIVFGFNTRSANGMLM
NMMMMSDENHRDIYISTVAVPPRGRCAACQDASRAHPGDPSAQCLRHGFMLHTKYQVVYP
FPTFQPAFQLKKDQVVLLNTSYSLVACAVSVH

DCAF15_WD40

PFAM accession number:	PF14939
Interpro abstract (IPR032734):	DCAFs, Ddb1- and Cul4-associated factors, are substrate receptors for the Cul4-Ddb1 Ubiquitin Ligase. There are 18 different factors, the majority of which are WD40-repeat-proteins [ (PUBMED:16949367) ]. This entry represents the WD40 repeat-containing domain found in DCAF15.

PFAM accession number:

PF14939

Interpro abstract (IPR032734):

DCAFs, Ddb1- and Cul4-associated factors, are substrate receptors for the Cul4-Ddb1 Ubiquitin Ligase. There are 18 different factors, the majority of which are WD40-repeat-proteins [ (PUBMED:16949367) ].

This entry represents the WD40 repeat-containing domain found in DCAF15.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DCAF15_WD40