The domain within your query sequence starts at position 3 and ends at position 52; the E-value for the DDA1 domain shown below is 1.2e-23.
DFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQKCCQEER
DDA1 |
---|
PFAM accession number: | PF10172 |
---|---|
Interpro abstract (IPR018276): | This entry represents the N-terminal domain of DDA1 (DET1- and DDB1-associated protein 1) ubiquitin ligase, which binds strongly with Det1 (De-etiolated 1) and DDB1 (Damaged DNA binding protein 1 associated 1). Together DDA1, DDB1 and Det1 form the DDD core complex, which recruits a specific UBE2E enzyme to form specific DDD-E2 complexes [ (PUBMED:17452440) ]. Component of the DDD-E2 complexes which may provide a platform for interaction with cul4a and WD repeat proteins. These proteins may be involved in ubiquitination and subsequent proteasomal degradation of target proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DDA1