The domain within your query sequence starts at position 250 and ends at position 411; the E-value for the DDE_Tnp_1_7 domain shown below is 1.1e-45.
NPVELFELFFDGETFNLIVNETNNYASQKNVSLEVTVQEMRCVFGVLLCSGFVRHPRMGM YWEISDSDQTLVRNEIRRDRFELIFSCLHFADNKHLDQKDKFSNLRPLIKQMKNFPLVCP PEEYYCFDKSMCECFDCDQFLNGKPLQIGYKIWCGTTNYARL
DDE_Tnp_1_7 |
![]() |
---|
PFAM accession number: | PF13843 |
---|---|
Interpro abstract (IPR029526): | This entry represents a domain found in the human PiggyBac transposable element-derived proteins (PGBDs) and some uncharacterised proteins. Its function is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DDE_Tnp_1_7