The domain within your query sequence starts at position 32 and ends at position 441; the E-value for the DDOST_48kD domain shown below is 4.5e-155.
TLVLLDNLNVRDTHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVED FGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDVSD LGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFP DKPITQYPHAVGRNTLLIAGLQARNNARVIFSGSLDFFSDAFFNSAVQKATPGAQRYSQT GNYELAVALSRWVFKEEGVLRVGPVSHHRVGEMAPPNAYTVTDLVEYSIIIEQLSNGKWV PFDGDDIQLEFVRIDPFVRTFLKRKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSST QVSVRPLQHTQYERFIPSAYPYYASAFSMMAGLFIFSIVFLHMKEKEKSD
DDOST_48kD |
---|
PFAM accession number: | PF03345 |
---|---|
Interpro abstract (IPR005013): | Members of this family are involved in asparagine-linked protein glycosylation. In particular, dolichyl-diphosphooligosaccharide-protein glycosyltransferase (DDOST), also known as oligosaccharyltransferase ( EC 2.4.1.119 ), transfers the high-mannose sugar GlcNAc(2)-Man(9)-Glc(3) from a dolichol-linked donor to an asparagine acceptor in a consensus Asn-X-Ser/Thr motif. In most eukaryotes, the DDOST complex is composed of three subunits, which in humans are described as a 48kDa subunit, ribophorin I, and ribophorin II [ (PUBMED:936767) ]. However, the yeast DDOST appears to consist of six subunits (alpha, beta, gamma, delta, epsilon, zeta). The yeast beta subunit is a 45kDa polypeptide, previously discovered as the Wbp1 protein, with known sequence similarity to the human 48kDa subunit and the other orthologues. This family includes the 48kDa-like subunits from several eukaryotes; it also includes the yeast DDOST beta subunit Wbp1. Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit Wbp1 is the beta subunit of the OST complex, one of the original six subunits purified [ (PUBMED:8175708) ]. Wbp1 is essential [ (PUBMED:1724755) (PUBMED:1600939) ], but conditional mutants have decreased transferase activity [ (PUBMED:1600939) (PUBMED:8428586) ]. |
GO process: | protein N-linked glycosylation via asparagine (GO:0018279) |
GO component: | endoplasmic reticulum membrane (GO:0005789) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DDOST_48kD