The domain within your query sequence starts at position 1 and ends at position 54; the E-value for the DDRGK domain shown below is 4.9e-14.

XKEEEERKAQEEQARREHEEYLKLKEAFVVEEEGVSETMTEEQVGPSLLGDLCH

DDRGK

• PFAM accession number: PF09756
• Interpro abstract (IPR019153):

  This is a family of proteins of approximately 300 residues. They contain a highly conserved DDRGK motif. The function is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DDRGK