The domain within your query sequence starts at position 423 and ends at position 485; the E-value for the DDT domain shown below is 2.3e-14.
EVFGDALMVLEFLNAFGELFDLQDEFPEGVTLAEVLEEALVGNDSEGPLCELLFFFLTAI FQA
DDT |
![]() |
---|
PFAM accession number: | PF02791 |
---|---|
Interpro abstract (IPR018501): | The DDT has been named after the better characterised DNA-binding homeobox- containing proteins and the Different Transcription and chromatin remodelling factors in which it is found. It is a domain of about 60 amino acids which is exclusively associated with nuclear domains like AT-Hook, PHD finger, methyl-CpG-binding domain, bromodomain and DNA-binding homeodomain. The DDT domain is characterised by a number of conserved aromatic and charged residues and is predicted to consist of three alpha helices. A DNA-binding function for the DDT domain has been proposed [ (PUBMED:11246006) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DDT