SMART: Pfam domain DDT

The domain within your query sequence starts at position 45 and ends at position 78; the E-value for the DDT domain shown below is 8.8e-10.

EVFGDALMVLEFLNAFGELFDLQDEFPEGVTLGD

DDT

PFAM accession number:	PF02791
Interpro abstract (IPR018501):	The DDT has been named after the better characterised DNA-binding homeobox- containing proteins and the Different Transcription and chromatin remodelling factors in which it is found. It is a domain of about 60 amino acids which is exclusively associated with nuclear domains like AT-Hook, PHD finger, methyl-CpG-binding domain, bromodomain and DNA-binding homeodomain. The DDT domain is characterised by a number of conserved aromatic and charged residues and is predicted to consist of three alpha helices. A DNA-binding function for the DDT domain has been proposed [ (PUBMED:11246006) ].

PFAM accession number:

PF02791

Interpro abstract (IPR018501):

The DDT has been named after the better characterised DNA-binding homeobox- containing proteins and the Different Transcription and chromatin remodelling factors in which it is found. It is a domain of about 60 amino acids which is exclusively associated with nuclear domains like AT-Hook, PHD finger, methyl-CpG-binding domain, bromodomain and DNA-binding homeodomain.

The DDT domain is characterised by a number of conserved aromatic and charged residues and is predicted to consist of three alpha helices. A DNA-binding function for the DDT domain has been proposed [ (PUBMED:11246006) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DDT